Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor gamma
LigandBDBM28699
Substrate/Competitorn/a
Meas. Tech.ChEMBL_154537
EC50 600000±n/a nM
Citation Willson TMCobb JECowan DJWiethe RWCorrea IDPrakash SRBeck KDMoore LBKliewer SALehmann JM The structure-activity relationship between peroxisome proliferator-activated receptor gamma agonism and the antihyperglycemic activity of thiazolidinediones. J Med Chem 39:665-8 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor gamma
Name:Peroxisome proliferator-activated receptor gamma
Synonyms:Nuclear receptor subfamily 1 group C member 3 | PPAR-gamma
Type:PROTEIN
Mol. Mass.:57593.55
Organism:Mus musculus
Description:ChEMBL_1453700
Residue:505
Sequence:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQL
LHVIKKTETDMSLHPLLQEIYKDLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM28699
n/a
NameBDBM28699
Synonyms:2-(4-chlorophenoxy)-2-methylpropanoic acid | CHEMBL683 | Clofibrate | Clofibrinic acid | clofibric acid
TypeSmall organic molecule
Emp. Form.C10H11ClO3
Mol. Mass.214.646
SMILESCC(C)(Oc1ccc(Cl)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: