| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50031869 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_55116 (CHEMBL884367) |
|---|
| IC50 | 17±n/a nM |
|---|
| Citation |  Gangjee, A; Zhu, Y; Queener, SF; Francom, P; Broom, AD Nonclassical 2,4-diamino-8-deazafolate analogues as inhibitors of dihydrofolate reductases from rat liver, Pneumocystis carinii, and Toxoplasma gondii. J Med Chem39:1836-45 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21638.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50031869 |
|---|
| n/a |
|---|
| Name | BDBM50031869 |
|---|
| Synonyms: | 6-(((3,4-dichlorophenyl)(methyl)amino)methyl)pyrido[3,2-d]pyrimidine-2,4-diamine | 6-{[(3,4-Dichloro-phenyl)-methyl-amino]-methyl}-pyrido[3,2-d]pyrimidine-2,4-diamine | 6-{[(4,5-Dichloro-phenyl)-methyl-amino]-methyl}-pyrido[3,2-d]pyrimidine-2,4-diamine | CHEMBL300603 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H14Cl2N6 |
|---|
| Mol. Mass. | 349.218 |
|---|
| SMILES | CN(Cc1ccc2nc(N)nc(N)c2n1)c1ccc(Cl)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
