Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50049806
Substrate/Competitorn/a
Meas. Tech.ChEMBL_146367
Ki 0.500000±n/a nM
Citation Cappelli AAnzini MVomero SMenziani MCDe Benedetti PGSbacchi MClarke GDMennuni L Synthesis, biological evaluation, and quantitative receptor docking simulations of 2-[(acylamino)ethyl]-1,4-benzodiazepines as novel tifluadom-like ligands with high affinity and selectivity for kappa-opioid receptors. J Med Chem 39:860-72 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:Kappa Opioid Receptor | OPIATE Kappa | Opiate Kappa 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42744.99
Organism:Cavia porcellus (domestic guinea pig)
Description:P41144
Residue:380
Sequence:
MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRV
RNTVQDPAYMRNVDGVNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50049806
n/a
NameBDBM50049806
Synonyms:CHEMBL127969 | Thiophene-2-carboxylic acid [2-(1-methyl-5-phenyl-2,3-dihydro-1H-benzo[e][1,4]diazepin-2-yl)-ethyl]-amide
TypeSmall organic molecule
Emp. Form.C23H23N3OS
Mol. Mass.389.513
SMILESCN1C(CCNC(=O)c2cccs2)CN=C(c2ccccc2)c2ccccc12 |t:15|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: