Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50049801 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_145152 (CHEMBL755956) |
---|
Ki | >100±n/a nM |
---|
Citation | Cappelli, A; Anzini, M; Vomero, S; Menziani, MC; De Benedetti, PG; Sbacchi, M; Clarke, GD; Mennuni, L Synthesis, biological evaluation, and quantitative receptor docking simulations of 2-[(acylamino)ethyl]-1,4-benzodiazepines as novel tifluadom-like ligands with high affinity and selectivity for kappa-opioid receptors. J Med Chem39:860-72 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50049801 |
---|
n/a |
---|
Name | BDBM50049801 |
Synonyms: | 4-Chloro-N-[2-(7-chloro-1-methyl-5-phenyl-2,3-dihydro-1H-benzo[e][1,4]diazepin-2-yl)-ethyl]-benzamide | CHEMBL340001 |
Type | Small organic molecule |
Emp. Form. | C25H23Cl2N3O |
Mol. Mass. | 452.376 |
SMILES | CN1C(CCNC(=O)c2ccc(Cl)cc2)CN=C(c2ccccc2)c2cc(Cl)ccc12 |t:17| |
Structure |
|