Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate Reductase (DHFR)
LigandBDBM50049911
Substrate/Competitorn/a
Meas. Tech.ChEMBL_54223
Ki 0.12±n/a nM
Citation Kuyper LFBaccanari DPJones MLHunter RNTansik RLJoyner SSBoytos CMRudolph SKKnick VWilson HRCaddell JMFriedman HSComley JCStables JN High-affinity inhibitors of dihydrofolate reductase: antimicrobial and anticancer activities of 7,8-dialkyl-1,3-diaminopyrrolo[3,2-f]quinazolines with small molecular size. J Med Chem 39:892-903 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate Reductase (DHFR)
Name:Dihydrofolate Reductase (DHFR)
Synonyms:Tetrahydrofolate dehydrogenase
Type:Enzyme
Mol. Mass.:22141.77
Organism:Candida albicans
Description:C. albicans DHFR was expressed in E. coli BL21, and purified to homogeneity.
Residue:192
Sequence:
MSKPNVAIIVAALKPALGIGYKGKMPWRLRKEIRYFKDVTTRTTKPNTRNAVIMGRKTWE
SIPQKFRPLPDRLNIILSRSYENKIIDDNIIHASSIESSLNLVSDVERVFIIGGAEIYNE
LINNSLVSHLLITEIEHPSPESIEMDTFLKFPLESWTKQPKSELQKFVGDTVLEDDIKEG
DFTYNYTLWTRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50049911
n/a
NameBDBM50049911
Synonyms:8-tert-Butyl-7H-pyrrolo[3,2-f]quinazoline-1,3-diamine | CHEMBL171305
TypeSmall organic molecule
Emp. Form.C14H17N5
Mol. Mass.255.3183
SMILESCC(C)(C)c1cc2c(ccc3nc(N)nc(N)c23)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: