| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50050430 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_196953 (CHEMBL801326) |
|---|
| IC50 | 970±n/a nM |
|---|
| Citation |  Flavin, MT; Rizzo, JD; Khilevich, A; Kucherenko, A; Sheinkman, AK; Vilaychack, V; Lin, L; Chen, W; Greenwood, EM; Pengsuparp, T; Pezzuto, JM; Hughes, SH; Flavin, TM; Cibulski, M; Boulanger, WA; Shone, RL; Xu, ZQ Synthesis, chromatographic resolution, and anti-human immunodeficiency virus activity of (+/-)-calanolide A and its enantiomers. J Med Chem39:1303-13 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50050430 |
|---|
| n/a |
|---|
| Name | BDBM50050430 |
|---|
| Synonyms: | (10S,12S)-12-Hydroxy-6,6,10,11-tetramethyl-4-propyl-11,12-dihydro-6H,10H-dipyrano[2,3-f;2',3'-h]chromen-2-one | CHEMBL282382 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H26O5 |
|---|
| Mol. Mass. | 370.4388 |
|---|
| SMILES | CCCc1cc(=O)oc2c3[C@@H](O)C(C)[C@H](C)Oc3c3C=CC(C)(C)Oc3c12 |c:20| |
|---|
| Structure | 
|
|---|
Search and Browse
