Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(4) dopamine receptor
LigandBDBM50050476
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63104
Ki 3.5±n/a nM
Citation Rowley MBroughton HBCollins IBaker REmms FMarwood RPatel SPatel SRagan CIFreedman SBLeeson PD 5-(4-Chlorophenyl)-4-methyl-3-(1-(2-phenylethyl)piperidin-4-yl)isoxazole: a potent, selective antagonist at human cloned dopamine D4 receptors. J Med Chem 39:1943-5 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(4) dopamine receptor
Name:D(4) dopamine receptor
Synonyms:D(2C) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | Dopamine D4 receptor
Type:Enzyme
Mol. Mass.:48373.19
Organism:Homo sapiens (Human)
Description:P21917
Residue:467
Sequence:
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP
PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50050476
n/a
NameBDBM50050476
Synonyms:4-[5-(4-Chloro-phenyl)-4-methyl-isoxazol-3-yl]-1-phenethyl-piperidine | 4-[5-(4-Chloro-phenyl)-4-methyl-isoxazol-3-yl]-1-phenethyl-piperidine (L-741742) | CHEMBL444309 | L-741742
TypeSmall organic molecule
Emp. Form.C23H25ClN2O
Mol. Mass.380.91
SMILESCc1c(noc1-c1ccc(Cl)cc1)C1CCN(CCc2ccccc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: