Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEDNRB
LigandBDBM50050805
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63518
Ki 1300±n/a nM
Citation Riechers HAlbrecht HPAmberg WBaumann EBernard HBöhm HJKlinge DKling AMüller SRaschack MUnger LWalker NWernet W Discovery and optimization of a novel class of orally active nonpeptidic endothelin-A receptor antagonists. J Med Chem 39:2123-8 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
EDNRB
Name:Endothelin receptor, ET-A/ET-B
Synonyms:ENDOTHELIN B | ET-B | Endothelin receptor ET-B | Endothelin receptor non-selective type | Endothelin receptor, ET-A/ET-B
Type:Enzyme Catalytic Domain
Mol. Mass.:49664.00
Organism:Homo sapiens (Human)
Description:ENDOTHELIN B EDNRB HUMAN::P24530
Residue:442
Sequence:
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA
SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50050805
n/a
NameBDBM50050805
Synonyms:2-(4,6-Dimethoxy-pyrimidin-2-yloxy)-3-methoxy-3,3-di-m-tolyl-propionic acid | CHEMBL65833
TypeSmall organic molecule
Emp. Form.C24H26N2O6
Mol. Mass.438.473
SMILESCOc1cc(OC)nc(OC(C(O)=O)C(OC)(c2cccc(C)c2)c2cccc(C)c2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: