Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibonucleoside-diphosphate reductase large chain
LigandBDBM50050824
Substrate/Competitorn/a
Meas. Tech.ChEMBL_195387
IC50 5±n/a nM
Citation Moss NBeaulieu PDuceppe JSFerland JMGauthier JGhiro EGoulet SGuse ILlinàs-Brunet MPlante RPlamondon LWernic DDéziel R Ureido-based peptidomimetic inhibitor of herpes simplex virus ribonucleotide reductase: an investigation of inhibitor bioactive conformation. J Med Chem 39:2178-87 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribonucleoside-diphosphate reductase large chain
Name:Ribonucleoside-diphosphate reductase large chain
Synonyms:ICP6 | R1 | Ribonucleoside-diphosphate reductase large subunit | Ribonucleotide reductase 136 kDa subunit | Ribonucleotide reductase large subunit
Type:PROTEIN
Mol. Mass.:124049.68
Organism:Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus1)
Description:ChEMBL_195109
Residue:1137
Sequence:
MASRPAASSPVEARAPVGGQEAGGPSAATQGEAAGAPLAHGHHVYCQRVNGVMVLSDKTP
GSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAPFVAVTNIGAGSDGGTAV
VAFGGTPRRSAGTSTGTQTADVPTEALGGPPPPPRFTLGGGCCSCRDTRRRSAVFGGEGD
PVGPAEFVSDDRSSDSDSDDSEDTDSETLSHASSDVSGGATYDDALDSDSSSDDSLQIDG
PVCRPWSNDTAPLDVCPGTPGPGADAGGPSAVDPHAPTPEAGAGLAADPAVARDDAEGLS
DPRPRLGTGTAYPVPLELTPENAEAVARFLGDAVNREPALMLEYFCRCAREETKRVPPRT
FGSPPRLTEDDFGLLNYALVEMQRLCLDVPPVPPNAYMPYYLREYVTRLVNGFKPLVSRS
ARLYRILGVLVHLRIRTREASFEEWLRSKEVALDFGLTERLREHEAQLVILAQALDHYDC
LIHSTPHTLVERGLQSALKYEEFYLKRFGGHYMESVFQMYTRIAGFLACRATRGMRHIAL
GREGSWWEMFKFFFHRLYDHQIVPSTPAMLNLGTRNYYTSSCYLVNPQATTNKATLRAIT
SNVSAILARNGGIGLCVQAFNDSGPGTASVMPALKVLDSLVAAHNKESARPTGACVYLEP
WHTDVRAVLRMKGVLAGEEAQRCDNIFSALWMPDLFFKRLIRHLDGEKNVTWTLFDRDTS
MSLADFHGEEFEKLYQHLEVMGFGEQIPIQELAYGIVRSAATTGSPFVMFKDAVNRHYIY
DTQGAAIAGSNLCTEIVHPASKRSSGVCNLGSVNLARCVSRQTFDFGRLRDAVQACVLMV
NIMIDSTLQPTPQCTRGNDNLRSMGIGMQGLHTACLKLGLDLESAEFQDLNKHIAEVMLL
SAMKTSNALCVRGARPFNHFKRSMYRAGRFHWERFPDARPRYEGEWEMLRQSMMKHGLRN
SQFVALMPTAASAQISDVSEGFAPLFTNLFSKVTRDGETLRPNTLLLKELERTFSGKRLL
EVMDSLDAKQWSVAQALPCLEPTHPLRRFKTAFDYDQKLLIDLCADRAPYVDHSQSMTLY
VTEKADGTLPASTLVRLLVHAYKRGLKTGMYYCKVRKATNSGVFGGDDNIVCMSCAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50050824
n/a
NameBDBM50050824
Synonyms:(S)-2-[(S)-3-Carboxy-2-((S)-2-{(S)-2-[(1-ethyl-propylcarbamoyl)-methyl]-3,3-dimethyl-butyrylamino}-4-oxo-4-pyrrolidin-1-yl-butyrylamino)-propionylamino]-4-methyl-pentanoic acid | CHEMBL70278
TypeSmall organic molecule
Emp. Form.C31H53N5O9
Mol. Mass.639.7806
SMILESCCC(CC)NC(=O)C[C@H](C(=O)N[C@@H](CC(=O)N1CCCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: