Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50041291
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63975
Ki 0.95±n/a nM
Citation Edwards PDAndisik DWStrimpler AMGomes BTuthill PA Nonpeptidic inhibitors of human neutrophil elastase. 7. Design, synthesis, and in vitro activity of a series of pyridopyrimidine trifluoromethyl ketones. J Med Chem 39:1112-24 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041291
n/a
NameBDBM50041291
Synonyms:2-[(R)-3-(1,1-Dimethyl-2-phenyl-ethyl)-2,4,8-trioxo-6-phenyl-2,3,4,8-tetrahydro-1H-pyrido[3,4-d]pyrimidin-7-yl]-N-(3,3,3-trifluoro-1-isopropyl-2-oxo-propyl)-acetamide | 2-[3-(1,1-Dimethyl-2-phenyl-ethyl)-2,4,8-trioxo-6-phenyl-2,3,4,8-tetrahydro-1H-pyrido[3,4-d]pyrimidin-7-yl]-N-(3,3,3-trifluoro-1-isopropyl-2-oxo-propyl)-acetamide | CHEMBL276307
TypeSmall organic molecule
Emp. Form.C31H31F3N4O5
Mol. Mass.596.5968
SMILESCC(C)C(NC(=O)Cn1c(cc2c([nH]c(=O)n(c2=O)C(C)(C)Cc2ccccc2)c1=O)-c1ccccc1)C(=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: