Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid receptor
LigandBDBM31892
Substrate/Competitorn/a
Meas. Tech.ChEMBL_197058
Ki 9±n/a nM
Citation Canan Koch SSDardashti LJHebert JJWhite SKCroston GEFlatten KSHeyman RANadzan AM Identification of the first retinoid X, receptor homodimer antagonist. J Med Chem 39:3229-34 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid receptor
Name:Retinoid receptor
Synonyms:Nuclear receptor subfamily 2 group B member 2 | Retinoic acid receptor RXR-beta | Retinoid X receptor beta
Type:PROTEIN
Mol. Mass.:56932.89
Organism:Homo sapiens (Human)
Description:ChEMBL_39045
Residue:533
Sequence:
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQT
PEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPP
PPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK
PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS
CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF
SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYP
EQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31892
n/a
NameBDBM31892
Synonyms:9-cis retinoic acid | 9C-RA | CHEMBL705 | Panretin | alitretinoin
TypeSmall organic molecule
Emp. Form.C20H28O2
Mol. Mass.300.4351
SMILESC\C(\C=C\C1=C(C)CCCC1(C)C)=C\C=C\C(\C)=C\C(O)=O |c:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: