| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cellular retinoic acid-binding protein 2 |
|---|
| Ligand | BDBM50031460 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_52401 (CHEMBL875705) |
|---|
| Kd | 1.4±n/a nM |
|---|
| Citation |  Muccio, DD; Brouillette, WJ; Alam, M; Vaezi, MF; Sani, BP; Venepally, P; Reddy, L; Li, E; Norris, AW; Simpson-Herren, L; Hill, DL Conformationally defined 6-s-trans-retinoic acid analogs. 3. Structure-activity relationships for nuclear receptor binding, transcriptional activity, and cancer chemopreventive activity. J Med Chem39:3625-35 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cellular retinoic acid-binding protein 2 |
|---|
| Name: | Cellular retinoic acid-binding protein 2 |
|---|
| Synonyms: | Cellular retinoic acid-binding protein II | Crabp2 | RABP2_MOUSE |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15744.92 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_52402 |
|---|
| Residue: | 138 |
|---|
| Sequence: | MPNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDTFYIKTSTTVR
TTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGEGPKTSWSRELTNDGEL
ILTMTADDVVCTRVYVRE
|
|
|
|---|
| BDBM50031460 |
|---|
| n/a |
|---|
| Name | BDBM50031460 |
|---|
| Synonyms: | (2E,4E,6E)-8-[3-Ethyl-2-isopropyl-cyclohex-2-en-(E)-ylidene]-3,7-dimethyl-octa-2,4,6-trienoic acid | CHEMBL46398 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H30O2 |
|---|
| Mol. Mass. | 314.4617 |
|---|
| SMILES | CCC1=C(C(C)C)\C(CCC1)=C\C(\C)=C\C=C\C(\C)=C\C(O)=O |c:2| |
|---|
| Structure | 
|
|---|
Search and Browse
