Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLTB4R
LigandBDBM50053350
Substrate/Competitorn/a
Meas. Tech.ChEMBL_99831
Ki 1.3±n/a nM
Citation Daines RAChambers PAFoley JJGriswold DEKingsbury WDMartin LDSchmidt DBSham KKSarau HM (E)-3-[6-[[(2,6-dichlorophenyl)thio]methyl]-3-(2-phenylethoxy)-2- pyridinyl]-2-propenoic acid: a high-affinity leukotriene B4 receptor antagonist with oral antiinflammatory activity. J Med Chem 39:3837-41 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
LTB4R
Name:Leukotriene B4 receptor
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50053350
n/a
NameBDBM50053350
Synonyms:(E)-3-[3-[2-(4-Chloro-phenyl)-ethoxy]-6-(2,6-dichloro-phenylsulfanylmethyl)-pyridin-2-yl]-acrylic acid | CHEMBL127376
TypeSmall organic molecule
Emp. Form.C23H18Cl3NO3S
Mol. Mass.494.818
SMILESOC(=O)\C=C\c1nc(CSc2c(Cl)cccc2Cl)ccc1OCCc1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: