Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain-2 (m-Calpain)
LigandBDBM50053856
Substrate/Competitorn/a
Meas. Tech.ChEMBL_43853
Ki 0.069000±n/a nM
Citation Li ZOrtega-Vilain ACPatil GSChu DLForeman JEEveleth DDPowers JC Novel peptidyl alpha-keto amide inhibitors of calpains and other cysteine proteases. J Med Chem 39:4089-98 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calpain-2 (m-Calpain)
Name:Calpain1/2
Synonyms:CANP 2 | Calcium-activated neutral proteinase 2 | Calpain 2 | Calpain M-type | Calpain large polypeptide L2 | Calpain-2 catalytic subunit | Calpain-2 large subunit | Calpain1/2 | M-calpain | Millimolar-calpain | calpain
Type:Protein
Mol. Mass.:79965.18
Organism:Homo sapiens (Human)
Description:n/a
Residue:700
Sequence:
MAGIAAKLAKDREAAEGLGSHDRAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGF
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN
CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG
EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFD
NFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50053856
n/a
NameBDBM50053856
Synonyms:CHEMBL131781 | {1-[1-(5-Hydroxy-1,3,3-trimethyl-cyclohexylmethyl)-aminooxalyl]-propylcarbamoyl}-3-methyl-butyl)-carbamic acid benzyl ester
TypeSmall organic molecule
Emp. Form.C29H45N3O6
Mol. Mass.531.6841
SMILESCCC(NC(=O)C(CC(C)C)NC(=O)OCc1ccccc1)C(=O)C(=O)NCC1(C)CC(O)CC(C)(C)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: