Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain1/2
LigandBDBM50042422
Substrate/Competitorn/a
Meas. Tech.ChEMBL_43668
Ki 0.68±n/a nM
Citation Li ZOrtega-Vilain ACPatil GSChu DLForeman JEEveleth DDPowers JC Novel peptidyl alpha-keto amide inhibitors of calpains and other cysteine proteases. J Med Chem 39:4089-98 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calpain1/2
Name:Calpain1/2
Synonyms:Calpain -type | Calpain-1 (u-Calpain) | Calpain-1 catalytic subunit
Type:Protein
Mol. Mass.:81880.51
Organism:Homo sapiens (Human)
Description:n/a
Residue:714
Sequence:
MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042422
n/a
NameBDBM50042422
Synonyms:CHEMBL117888 | {1-[1-(Cyclohexylmethyl-aminooxalyl)-propylcarbamoyl]-3-methyl-butyl}-carbamic acid benzyl ester
TypeSmall organic molecule
Emp. Form.C26H39N3O5
Mol. Mass.473.605
SMILESCCC(NC(=O)C(CC(C)C)NC(=O)OCc1ccccc1)C(=O)C(=O)NCC1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: