| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50054125 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_39464 (CHEMBL653039) |
|---|
| IC50 | 1.7±n/a nM |
|---|
| Citation |  Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS Molecular basis of peripheral vs central benzodiazepine receptor selectivity in a new class of peripheral benzodiazepine receptor ligands related to alpidem. J Med Chem39:4275-84 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50054125 |
|---|
| n/a |
|---|
| Name | BDBM50054125 |
|---|
| Synonyms: | (E)-2-(2-(4-chlorophenyl)-1,2-dihydro-1-oxo-3H-pyrrolo[3,4-b]quinolin-3-ylidene-N-(4-metoxyphenyl)-N-methylacetamide | 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-(4-methoxy-phenyl)-N-methyl-acetamide | CHEMBL135870 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H20ClN3O3 |
|---|
| Mol. Mass. | 469.919 |
|---|
| SMILES | COc1ccc(cc1)N(C)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
