Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1B |
---|
Ligand | BDBM10755 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1353 (CHEMBL616538) |
---|
Ki | 6.8±n/a nM |
---|
Citation | Halazy, S; Perez, M; Fourrier, C; Pallard, I; Pauwels, PJ; Palmier, C; John, GW; Valentin, JP; Bonnafous, R; Martinez, J Serotonin dimers: application of the bivalent ligand approach to the design of new potent and selective 5-HT(1B/1D) agonists. J Med Chem39:4920-7 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1B |
---|
Name: | 5-hydroxytryptamine receptor 1B |
Synonyms: | 5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | 5HT1B_HUMAN | HTR1B | HTR1DB | S12 | Serotonin (5-HT) receptor | Serotonin 1D beta receptor | Serotonin Receptor 1B |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 43579.17 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells |
Residue: | 390 |
Sequence: | MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
|
|
|
BDBM10755 |
---|
n/a |
---|
Name | BDBM10755 |
Synonyms: | 14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT |
Type | Small organic molecule |
Emp. Form. | C10H12N2O |
Mol. Mass. | 176.2151 |
SMILES | NCCc1c[nH]c2ccc(O)cc12 |
Structure |
|