Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50055588
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157575
Ki 0.037±n/a nM
Citation Jadhav PKAla PWoerner FJChang CHGarber SSAnton EDBacheler LT Cyclic urea amides: HIV-1 protease inhibitors with low nanomolar potency against both wild type and protease inhibitor resistant mutants of HIV. J Med Chem 40:181-91 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50055588
n/a
NameBDBM50055588
Synonyms:CHEMBL301219 | N-(1H-Benzoimidazol-2-yl)-3-((4R,5S,6S,7R)-4,7-dibenzyl-3-cyclopropylmethyl-5,6-dihydroxy-2-oxo-[1,3]diazepan-1-ylmethyl)-benzamide
TypeSmall organic molecule
Emp. Form.C38H39N5O4
Mol. Mass.629.7474
SMILESO[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2cccc(c2)C(=O)Nc2nc3ccccc3[nH]2)C(=O)N(CC2CC2)[C@@H]1Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: