| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50055593 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157575 (CHEMBL763326) |
|---|
| Ki | 0.033±n/a nM |
|---|
| Citation |  Jadhav, PK; Ala, P; Woerner, FJ; Chang, CH; Garber, SS; Anton, ED; Bacheler, LT Cyclic urea amides: HIV-1 protease inhibitors with low nanomolar potency against both wild type and protease inhibitor resistant mutants of HIV. J Med Chem40:181-91 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50055593 |
|---|
| n/a |
|---|
| Name | BDBM50055593 |
|---|
| Synonyms: | CHEMBL292905 | N-(1H-Imidazol-2-yl)-3-((4R,5S,6S,7R)-3,4,7-tribenzyl-5,6-dihydroxy-2-oxo-[1,3]diazepan-1-ylmethyl)-benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H37N5O4 |
|---|
| Mol. Mass. | 615.7208 |
|---|
| SMILES | O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2cccc(c2)C(=O)Nc2ncc[nH]2)C(=O)N(Cc2ccccc2)[C@@H]1Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
