Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C, eta
LigandBDBM3151
Substrate/Competitorn/a
Meas. Tech.ChEMBL_161125
IC50 90±n/a nM
Citation Lai YSMendoza JSJagdmann GEMenaldino DSBiggers CKHeerding JMWilson JWHall SEJiang JBJanzen WPBallas LM Synthesis and protein kinase C inhibitory activities of balanol analogs with replacement of the perhydroazepine moiety. J Med Chem 40:226-35 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C, eta
Name:Protein kinase C, PKC; classical/novel
Synonyms:PKC-L | nPKC-eta
Type:Enzyme
Mol. Mass.:77844.26
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:683
Sequence:
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGIDNFEFIRV
LGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM3151
n/a
NameBDBM3151
Synonyms:2-{[2,6-dihydroxy-4-({[(3R,4R)-3-[(4-hydroxybenzene)amido]piperidin-4-yl]oxy}carbonyl)phenyl]carbonyl}-3-hydroxybenzoic acid | Balanol analog 3 | CHEMBL67442
TypeSmall organic molecule
Emp. Form.C27H24N2O10
Mol. Mass.536.4869
SMILESOC(=O)c1cccc(O)c1C(=O)c1c(O)cc(cc1O)C(=O)O[C@@H]1CCNC[C@H]1NC(=O)c1ccc(O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: