Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C, gamma
LigandBDBM50055672
Substrate/Competitorn/a
Meas. Tech.ChEMBL_161269
IC50 5±n/a nM
Citation Lai YSMendoza JSJagdmann GEMenaldino DSBiggers CKHeerding JMWilson JWHall SEJiang JBJanzen WPBallas LM Synthesis and protein kinase C inhibitory activities of balanol analogs with replacement of the perhydroazepine moiety. J Med Chem 40:226-35 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C, gamma
Name:Protein kinase C, PKC; classical/novel
Synonyms:PKC gamma | PKC-gamma | Protein kinase C gamma | Protein kinase C gamma type
Type:Enzyme
Mol. Mass.:78458.05
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:697
Sequence:
MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50055672
n/a
NameBDBM50055672
Synonyms:4-(2-Carboxy-6-hydroxy-benzoyl)-3,5-dihydroxy-benzoic acid (1R,2R,4S)-2-(4-hydroxy-benzoylamino)-4-hydroxymethyl-cyclopentyl ester | CHEMBL75661
TypeSmall organic molecule
Emp. Form.C28H25NO11
Mol. Mass.551.4982
SMILESOC[C@H]1C[C@@H](NC(=O)c2ccc(O)cc2)[C@@H](C1)OC(=O)c1cc(O)c(C(=O)c2c(O)cccc2C(O)=O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: