Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEDNRA
LigandBDBM50056075
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63343
IC50 1.3±n/a nM
Citation Tasker ASSorensen BKJae HSWinn Mvon Geldern TWDixon DBChiou WJDayton BDCalzadila SHernandez LMarsh KCWuWong JROpgenorth TJ Potent and selective non-benzodioxole-containing endothelin-A receptor antagonists. J Med Chem 40:322-30 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
EDNRA
Name:Endothelin receptor
Synonyms:ENDOTHELIN A | Endothelin receptor | Endothelin-1 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48256.91
Organism:RAT
Description:ENDOTHELIN A EDNRA RAT::P26684
Residue:426
Sequence:
MGVLCFLASFWLALVGGAIADNAERYSANLSSHVEDFTPFPGTEFNFLGTTLQPPNLALP
SNGSMHGYCPQQTKITTAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEQHRTCM
LNATTKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNHNTERSS
HKDSMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056075
n/a
NameBDBM50056075
Synonyms:(2R,3R,4S)-1-Dibutylcarbamoylmethyl-2,4-bis-(4-methoxy-phenyl)-pyrrolidine-3-carboxylic acid | CHEMBL113529
TypeSmall organic molecule
Emp. Form.C29H40N2O5
Mol. Mass.496.6383
SMILESCCCCN(CCCC)C(=O)CN1C[C@@H]([C@H]([C@@H]1c1ccc(OC)cc1)C(O)=O)c1ccc(OC)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: