Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThermolysin
LigandBDBM50056252
Substrate/Competitorn/a
Meas. Tech.ChEMBL_210397
IC50 68±n/a nM
Citation Ksander GMde Jesus RYuan AGhai RDMcMartin CBohacek R Meta-substituted benzofused macrocyclic lactams as zinc metalloprotease inhibitors. J Med Chem 40:506-14 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thermolysin
Name:Thermolysin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:60097.54
Organism:Bacillus thermoproteolyticus
Description:ChEMBL_1468794
Residue:548
Sequence:
MKMKMKLASFGLAAGLAAQVFLPYNALASTEHVTWNQQFQTPQFISGDLLKVNGTSPEEL
VYQYVEKNENKFKFHENAKDTLQLKEKKNDNLGFTFMRFQQTYKGIPVFGAVVTSHVKDG
TLTALSGTLIPNLDTKGSLKSGKKLSEKQARDIAEKDLVANVTKEVPEYEQGKDTEFVVY
VNGDEASLAYVVNLNFLTPEPGNWLYIIDAVDGKILNKFNQLDAAKPGDVKSITGTSTVG
VGRGVLGDQKNINTTYSTYYYLQDNTRGNGIFTYDAKYRTTLPGSLWADADNQFFASYDA
PAVDAHYYAGVTYDYYKNVHNRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQMVYGDGDGQ
TFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEI
GEDVYTPGISGDSLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKAAYLISQGG
THYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQ
AFDAVGVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056252
n/a
NameBDBM50056252
Synonyms:(6S,9S)-6-Mercaptomethyl-7-oxo-6,7,8,9,10,11,12,13-octahydro-5H-8-aza-benzocycloundecene-9-carboxylic acid | CHEMBL150222
TypeSmall organic molecule
Emp. Form.C16H21NO3S
Mol. Mass.307.408
SMILESOC(=O)[C@@H]1CCCCc2ccccc2C[C@H](CS)C(=O)N1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: