Reaction Details |
| Report a problem with these data |
Target | Nitroreductase NfsA |
---|
Ligand | BDBM50057439 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_206006 (CHEMBL840569) |
---|
IC50 | 207000±n/a nM |
---|
Citation | Friedlos, F; Denny, WA; Palmer, BD; Springer, CJ Mustard prodrugs for activation by Escherichia coli nitroreductase in gene-directed enzyme prodrug therapy. J Med Chem40:1270-5 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nitroreductase NfsA |
---|
Name: | Nitroreductase NfsA |
Synonyms: | Modulator of drug activity A |
Type: | PROTEIN |
Mol. Mass.: | 26851.30 |
Organism: | Escherichia coli O157:H7 |
Description: | ChEMBL_206006 |
Residue: | 240 |
Sequence: | MTPTIELTCGHRSIRHFTDEPISEAQREAIINSARATSSSSFLQCSSIIRITDKALREEL
VTLTGGQKHVAQAAEFWVFCADFNRHLQICPDAQLGLAEQLLLGVVDTAMMAQNALTAAE
SLGLGGVYIGGLRNNIEAVTKLLKLPQHVLPLFGLCLGWPADNPDLKPRLPSSILVHENS
YQPLDKDALAQYDEQLAEYYLTRGSNNRRDTWSDHIRRTIIKESRPFILDYLHKQGWATR
|
|
|
BDBM50057439 |
---|
n/a |
---|
Name | BDBM50057439 |
Synonyms: | Bis-(2-chloro-ethyl)-(5-nitro-thiazol-2-yl)-amine | CHEMBL282461 |
Type | Small organic molecule |
Emp. Form. | C7H9Cl2N3O2S |
Mol. Mass. | 270.136 |
SMILES | [O-][N+](=O)c1cnc(s1)N(CCCl)CCCl |
Structure |
|