Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 reverse transcriptase
LigandBDBM50057810
Substrate/Competitorn/a
Meas. Tech.ChEMBL_197125
EC50 90±n/a nM
Citation Adams DRPerez CMaillard MFlorent JCEvers MHénin YLitvak SLitvak LMonneret CGrierson DS Preparation and anti-HIV activity of N-3-substituted thymidine nucleoside analogs. J Med Chem 40:1550-8 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 reverse transcriptase
Name:Human immunodeficiency virus type 1 reverse transcriptase
Synonyms:Reverse transcriptase/RNaseH
Type:PROTEIN
Mol. Mass.:65229.15
Organism:Human immunodeficiency virus 1
Description:ChEMBL_1473730
Residue:566
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLRTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVLFLDGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50057810
n/a
NameBDBM50057810
Synonyms:1-(4-Azido-5-hydroxymethyl-tetrahydro-furan-2-yl)-3-(2-hydroxy-ethyl)-5-methyl-1H-pyrimidine-2,4-dione | CHEMBL290327
TypeSmall organic molecule
Emp. Form.C12H17N5O5
Mol. Mass.311.2939
SMILESCc1cn(C2CC(N=[N+]=[N-])C(CO)O2)c(=O)n(CCO)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: