| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM50058235 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_27901 (CHEMBL640561) |
|---|
| Ki | 0.450000±n/a nM |
|---|
| Citation |  Pfister, JR; Belardinelli, L; Lee, G; Lum, RT; Milner, P; Stanley, WC; Linden, J; Baker, SP; Schreiner, G Synthesis and biological evaluation of the enantiomers of the potent and selective A1-adenosine antagonist 1,3-dipropyl-8-[2-(5,6-epoxynorbonyl)]-xanthine. J Med Chem40:1773-8 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36520.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30542 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
|---|
| BDBM50058235 |
|---|
| n/a |
|---|
| Name | BDBM50058235 |
|---|
| Synonyms: | 8-(3-Oxa-tricyclo[3.2.1.0*2,4*]oct-6-yl)-1,3-dipropyl-3,7-dihydro-purine-2,6-dione | CHEMBL298474 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H24N4O3 |
|---|
| Mol. Mass. | 344.4082 |
|---|
| SMILES | CCCn1c2nc([nH]c2c(=O)n(CCC)c1=O)C1CC2CC1C1OC21 |THB:6:17:22.24:20,23:22:20:17.18,23:24:20:17.18| |
|---|
| Structure | 
|
|---|
Search and Browse
