| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Folate receptor alpha |
|---|
| Ligand | BDBM50059343 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_68374 (CHEMBL678783) |
|---|
| Kd | 83±n/a nM |
|---|
| Citation |  Varney, MD; Palmer, CL; Romines, WH; Boritzki, T; Margosiak, SA; Almassy, R; Janson, CA; Bartlett, C; Howland, EJ; Ferre, R Protein structure-based design, synthesis, and biological evaluation of 5-thia-2,6-diamino-4(3H)-oxopyrimidines: potent inhibitors of glycinamide ribonucleotide transformylase with potent cell growth inhibition. J Med Chem40:2502-24 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Folate receptor alpha |
|---|
| Name: | Folate receptor alpha |
|---|
| Synonyms: | Adult folate-binding protein | FBP | FOLR | FOLR1 | FOLR1_HUMAN | FR-alpha | Folate receptor 1 | Folate receptor, adult | KB cells FBP | Ovarian tumor-associated antigen MOv18 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29827.41 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1469596 |
|---|
| Residue: | 257 |
|---|
| Sequence: | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPW
RKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQV
DQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHF
YFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWA
AWPFLLSLALMLLWLLS
|
|
|
|---|
| BDBM50059343 |
|---|
| n/a |
|---|
| Name | BDBM50059343 |
|---|
| Synonyms: | (S)-2-({5-[2-(2,4-Diamino-6-oxo-1,6-dihydro-pyrimidin-5-ylsulfanyl)-ethyl]-thiophene-2-carbonyl}-amino)-pentanedioic acid | CHEMBL85848 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H19N5O6S2 |
|---|
| Mol. Mass. | 441.482 |
|---|
| SMILES | Nc1nc(N)c(SCCc2ccc(s2)C(=O)N[C@@H](CCC(O)=O)C(O)=O)c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
