Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArachidonate 5-lipoxygenase
LigandBDBM50059605
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157767
IC50 5000±n/a nM
Citation Müller KPrinz H Antipsoriatic anthrones with modulated redox properties. 4. Synthesis and biological activity of novel 9,10-dihydro-1,8-dihydroxy-9-oxo-2-anthracenecarboxylic and -hydroxamic acids. J Med Chem 40:2780-7 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Arachidonate 5-lipoxygenase
Name:Arachidonate 5-lipoxygenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:49994.23
Organism:Bos taurus
Description:ChEMBL_157766
Residue:430
Sequence:
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGDIQLIKIEKRKYWFHDDWYLKYITVKTPCGDYIEFPCYRWISGEGEIVLRDGQAKLA
CDDQIHVLKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWSDFADFEKIFVRISNTISERVMNHWQEDRMFGYQFLNG
CNPVMIQRCLKLPDNLPVTTEMVECSLERQLTLEQEIEQGNIFIVDFKLLDGIDANKTDP
CTLQFLAAPICLLYKNLANKIVPIAIQLNQVPGEENPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICEYG
LFDKANATGG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50059605
n/a
NameBDBM50059605
Synonyms:4-(1,8-Dihydroxy-9-oxo-9,10-dihydro-anthracen-2-ylmethyl)-N-hydroxy-benzamide | CHEMBL96929
TypeSmall organic molecule
Emp. Form.C22H17NO5
Mol. Mass.375.3741
SMILESONC(=O)c1ccc(Cc2ccc3Cc4cccc(O)c4C(=O)c3c2O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: