| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50059957 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_55294 (CHEMBL665205) |
|---|
| Ki | 0.014±n/a nM |
|---|
| Citation |  Robson, C; Meek, MA; Grunwaldt, JD; Lambert, PA; Queener, SF; Schmidt, D; Griffin, RJ Nonclassical 2,4-diamino-5-aryl-6-ethylpyrimidine antifolates: activity as inhibitors of dihydrofolate reductase from Pneumocystis carinii and Toxoplasma gondii and as antitumor agents. J Med Chem40:3040-8 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21638.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50059957 |
|---|
| n/a |
|---|
| Name | BDBM50059957 |
|---|
| Synonyms: | 4-({[4-(2,4-Diamino-6-ethyl-pyrimidin-5-yl)-2-nitro-phenyl]-methyl-amino}-methyl)-benzoic acid methyl ester | CHEMBL449706 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H24N6O4 |
|---|
| Mol. Mass. | 436.4638 |
|---|
| SMILES | CCc1nc(N)nc(N)c1-c1ccc(N(C)Cc2ccc(cc2)C(=O)OC)c(c1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
