Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin G
LigandBDBM50279770
Substrate/Competitorn/a
Meas. Tech.ChEMBL_45530
pH7.5±n/a
Ki>15000±n/a nM
Commentsextracted
Citation Regan JMcGarry DBruno JGreen DNewman JHsu CYKline JBarton JTravis JChoi YMVolz FPauls HHarrison RZilberstein ABen-Sasson SAChang M Anionic- and lipophilic-mediated surface binding inhibitors of human leukocyte elastase. J Med Chem 40:3408-22 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin G
Name:Cathepsin G
Synonyms:CG
Type:PROTEIN
Mol. Mass.:28860.08
Organism:Homo sapiens (Human)
Description:ChEMBL_1469016
Residue:255
Sequence:
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50279770
n/a
NameBDBM50279770
Synonyms:2-{4-benzyloxy-5-[5-benzyloxy-4-(5-benzyloxy-4-{5-benzyloxy-4-[5-benzyloxy-2-carboxymethoxy-4-(2-carboxymethoxy-5-hydroxybenzyl)benzyl]-2-carboxymethoxybenzyl}-2-carboxymethoxybenzyl)-2-carboxymethoxybenzyl]-2-hydroxymethylphenoxy}acetic acid.H2O | CHEMBL267968
TypeSmall organic molecule
Emp. Form.C89H80O25
Mol. Mass.1549.5725
SMILESOCc1cc(OCc2ccccc2)c(Cc2cc(OCc3ccccc3)c(Cc3cc(OCc4ccccc4)c(Cc4cc(OCc5ccccc5)c(Cc5cc(OCc6ccccc6)c(Cc6cc(O)ccc6OCC(O)=O)cc5OCC(O)=O)cc4OCC(O)=O)cc3OCC(O)=O)cc2OCC(O)=O)cc1OCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: