Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin-releasing hormone receptor
LigandBDBM50060790
Substrate/Competitorn/a
Meas. Tech.ChEMBL_71736
IC50 5±n/a nM
Citation Jiang GMiller CKoerber SCPorter JCraig AGBhattacharjee SKraft PBurris TPCampen CARivier CLRivier JE Betidamino acid scan of the GnRH antagonist acyline. J Med Chem 40:3739-48 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin-releasing hormone receptor
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R
Type:PROTEIN
Mol. Mass.:37767.60
Organism:Rattus norvegicus
Description:ChEMBL_1335047
Residue:327
Sequence:
MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKL
QRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRM
IYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRV
LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVS
EPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060790
n/a
NameBDBM50060790
Synonyms:CHEMBL444903 | D/LAgl (Ac)7]acyline
TypeSmall organic molecule
Emp. Form.C78H97ClN16O15
Mol. Mass.1534.156
SMILESCC(C)NCCCC[C@H](NC(=O)[C@H](NC(C)=O)NC(=O)[C@@H](Cc1ccc(NC(C)=O)cc1)NC(=O)[C@H](Cc1ccc(NC(C)=O)cc1)NC(=O)[C@H](CO)NC(=O)[C@@H](Cc1cccnc1)NC(=O)[C@@H](Cc1ccc(Cl)cc1)NC(=O)[C@@H](Cc1ccc2ccccc2c1)NC(C)=O)C(=O)N1CCC[C@@H]1C(=O)N[C@H](C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: