Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 2a (5-HT2a) receptor
LigandBDBM50060965
Substrate/Competitorn/a
Meas. Tech.ChEMBL_2239
Ki 83±n/a nM
Citation Meyer MDAltenbach RJBasha FZCarroll WADrizin IElmore SWEhrlich PPLebold SATietje KSippy KBWendt MDPlata DJPlagge FBuckner SABrune MEHancock AAKerwin JF Synthesis and pharmacological characterization of 3-[2-((3aR,9bR)-cis-6-methoxy-2,3,3a,4,5,9b-hexahydro-1H-benz[e] isoindol-2-yl)ethyl]pyrido-[3',4':4,5]thieno[3,2-d]pyrimidine-2,4 (1H,3H)-dione (A-131701): a uroselective alpha 1A adrenoceptor antagonist for the symptomatic treatment of benign pr J Med Chem 40:3141-3 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 2a (5-HT2a) receptor
Name:Serotonin 2a (5-HT2a) receptor
Synonyms:5-HT2A
Type:Enzyme Catalytic Domain
Mol. Mass.:52578.24
Organism:BOVINE
Description:5-HT2A HTR2A BOVINE::Q75Z89
Residue:470
Sequence:
MDILCEENTSLSSTTNSLMQLHADTRLYSTDFNSGEGNTSNAFNWTVDSENRTNLSCEGC
LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSTLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADENFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDPGTRTKLASFSFLPQSSLSSEKLFQRSIH
REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNRDVIEAL
LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS
SQLQMGPKKNSKKDDKTTDNDCTMVALGKEHPEDAPADSSNTVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060965
n/a
NameBDBM50060965
Synonyms:2-[2-((3aR,9bR)-6-Methoxy-1,3,3a,4,5,9b-hexahydro-benzo[e]isoindol-2-yl)-ethyl]-4H-9-thia-2,4,5-triaza-fluorene-1,3-dione | 2-[2-((3aR,9bR)-6-Methoxy-1,3,3a,4,5,9b-hexahydro-benzo[e]isoindol-2-yl)-ethyl]-4H-9-thia-2,4,6-triaza-fluorene-1,3-dione | 2-[2-(6-Methoxy-1,3,3a,4,5,9b-hexahydro-benzo[e]isoindol-2-yl)-ethyl]-4H-9-thia-2,4,5-triaza-fluorene-1,3-dione | A-131701 | CHEMBL40650
TypeSmall organic molecule
Emp. Form.C24H24N4O3S
Mol. Mass.448.537
SMILESCOc1cccc2[C@@H]3CN(CCn4c(=O)[nH]c5c6ncccc6sc5c4=O)C[C@@H]3CCc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: