Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50061025
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63839
Ki 8.9±n/a nM
Citation Veale CABernstein PRBohnert CMBrown FJBryant CDamewood JREarley RFeeney SWEdwards PDGomes BHulsizer JMKosmider BJKrell RDMoore GSalcedo TWShaw ASilberstein DSSteelman GBStein MStrimpler AThomas RMVacek EPWilliams JCWolanin DJWoolson S Orally active trifluoromethyl ketone inhibitors of human leukocyte elastase. J Med Chem 40:3173-81 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061025
n/a
NameBDBM50061025
Synonyms:(S)-1-[(S)-2-(4-Methoxy-benzoylamino)-3-methyl-butyryl]-pyrrolidine-2-carboxylic acid ((S)-3,3-difluoro-1-isopropyl-2-oxo-3-propylcarbamoyl-propyl)-amide | CHEMBL105981
TypeSmall organic molecule
Emp. Form.C28H40F2N4O6
Mol. Mass.566.6372
SMILESCCCNC(=O)C(F)(F)C(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)c1ccc(OC)cc1)C(C)C)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: