Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 19A1
LigandBDBM50061156
Substrate/Competitorn/a
Meas. Tech.ChEMBL_50543
Ki 10±n/a nM
Citation Akkani APaterlini GGleason WBOjala WHAbul-Hajj YJ 6 beta-Propynyl-substituted steroids: mechanism-based enzyme-activated irreversible inhibitors of aromatase. J Med Chem 40:3263-70 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 19A1
Name:Cytochrome P450 19A1
Synonyms:Aromatase | CYPXIX | Cytochrome P-450AROM | Cytochrome P450 2C19 | Cytochrome P450-C19 (CYP19) | Estrogen synthetase | FL cytokine receptor precursor | P-450AROM
Type:Enzyme
Mol. Mass.:57888.92
Organism:Homo sapiens (Human)
Description:P11511
Residue:503
Sequence:
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061156
n/a
NameBDBM50061156
Synonyms:(S)-10,13-Dimethyl-6-prop-2-ynyl-1,6,7,8,9,10,11,12,13,14,15,16-dodecahydro-2H-cyclopenta[a]phenanthrene-3,17-dione | CHEMBL113082
TypeSmall organic molecule
Emp. Form.C22H28O2
Mol. Mass.324.4565
SMILESCC12CCC3C(C[C@@H](CC#C)C4=CC(=O)CCC34C)C1CCC2=O |t:11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: