| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50061197 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_47006 (CHEMBL658675) |
|---|
| Ki | 23±n/a nM |
|---|
| Citation |  Reggio, PH; Wang, T; Brown, AE; Fleming, DN; Seltzman, HH; Griffin, G; Pertwee, RG; Compton, DR; Abood, ME; Martin, BR Importance of the C-1 substituent in classical cannabinoids to CB2 receptor selectivity: synthesis and characterization of a series of O,2-propano-delta 8-tetrahydrocannabinol analogs. J Med Chem40:3312-8 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CNR2_RAT | Cannabinoid CB2 receptor | Cannabinoid receptor | Cnr2 | rCB2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39366.68 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q9QZN9 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
|
|
|
|---|
| BDBM50061197 |
|---|
| n/a |
|---|
| Name | BDBM50061197 |
|---|
| Synonyms: | (R)-8,8-Dimethyl-5-pentyl-3,4,8,8a,9,10,12,12a-octahydro-2H-1,7-dioxa-benzo[c]phenanthren-11-one | CHEMBL109758 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H32O3 |
|---|
| Mol. Mass. | 356.4984 |
|---|
| SMILES | CCCCCc1cc2OC(C)(C)[C@@H]3CCC(=O)CC3c2c2OCCCc12 |
|---|
| Structure | 
|
|---|
Search and Browse
