Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman rhinovirus A protease
LigandBDBM50061532
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158975
IC50 100±n/a nM
Citation Ogilvie WBailey MPoupart MAAbraham ABhavsar ABonneau PBordeleau JBousquet YChabot CDuceppe JSFazal GGoulet SGrand-Maître CGuse IHalmos TLavallée PLeach MMalenfant EO'Meara JPlante RPlouffe CPoirier MSoucy FYoakim CDéziel R Peptidomimetic inhibitors of the human cytomegalovirus protease. J Med Chem 40:4113-35 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human rhinovirus A protease
Name:Human rhinovirus A protease
Synonyms:Human rhinovirus B 3A protease
Type:PROTEIN
Mol. Mass.:44361.04
Organism:Human rhinovirus B
Description:ChEMBL_158953
Residue:401
Sequence:
AFRPCNVNTKIGNAKCCPFVCGKAVTFKDRSTCSTYNLSSSLHHILEEDKRRRQVVDVMS
AIFQGPISLDAPPPPAIADLLQSVRTPRVIKYCQIIMGHPAECQVERDLNIANSIIAIIA
NIISIAGIIFVIYKLFCSLQGPYSGEPKPKTKVPERRVVAQGPEEEFGRSILKNNTCVIT
TGNGKFTGLGIHDRILIIPTHADPGREVQVNGVHTKVLDSYDLYNRDGVKLEITVIQLDR
NEKFRDIRKYIPETEDDYPECNLALSANQDEPTIIKVGDVVSYGNILLSGNQTARMLKYN
YPTKSGYCGGVLYKIGQILGIHVGGNGRDGFSAMLLRSYFTGQIKVNKHATECGLPDIQT
IHTPSKTKLQPSVFYDVFPGSKEPAVLTDNDPRLEVNFKEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061532
n/a
NameBDBM50061532
Synonyms:(S)-N*1*-{2-[(Benzo[1,3]dioxol-5-ylmethyl)-carbamoyl]-1-methyl-2-oxo-ethyl}-2-[(S)-2-(3,3-dimethyl-butyrylamino)-3,3-dimethyl-butyrylamino]-N*4*,N*4*-dimethyl-succinamide | CHEMBL334884
TypeSmall organic molecule
Emp. Form.C30H45N5O8
Mol. Mass.603.707
SMILESCC(NC(=O)[C@H](CC(=O)N(C)C)NC(=O)[C@@H](NC(=O)CC(C)(C)C)C(C)(C)C)C(=O)C(=O)NCc1ccc2OCOc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: