Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM50061509 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_33820 (CHEMBL646850) |
---|
IC50 | >300000±n/a nM |
---|
Citation | Ogilvie, W; Bailey, M; Poupart, MA; Abraham, A; Bhavsar, A; Bonneau, P; Bordeleau, J; Bousquet, Y; Chabot, C; Duceppe, JS; Fazal, G; Goulet, S; Grand-Maître, C; Guse, I; Halmos, T; Lavallée, P; Leach, M; Malenfant, E; O'Meara, J; Plante, R; Plouffe, C; Poirier, M; Soucy, F; Yoakim, C; Déziel, R Peptidomimetic inhibitors of the human cytomegalovirus protease. J Med Chem40:4113-35 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM50061509 |
---|
n/a |
---|
Name | BDBM50061509 |
Synonyms: | (S)-2-[(S)-2-(3,3-Dimethyl-butyrylamino)-3,3-dimethyl-butyrylamino]-N*4*,N*4*-dimethyl-N*1*-[1-methyl-2-(5-methyl-benzooxazol-2-yl)-2-oxo-ethyl]-succinamide | CHEMBL133854 |
Type | Small organic molecule |
Emp. Form. | C29H43N5O6 |
Mol. Mass. | 557.6816 |
SMILES | CC(NC(=O)[C@H](CC(=O)N(C)C)NC(=O)[C@@H](NC(=O)CC(C)(C)C)C(C)(C)C)C(=O)c1nc2cc(C)ccc2o1 |
Structure |
|