Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic elastase
LigandBDBM50061509
Substrate/Competitorn/a
Meas. Tech.ChEMBL_156950
IC50 200±n/a nM
Citation Ogilvie WBailey MPoupart MAAbraham ABhavsar ABonneau PBordeleau JBousquet YChabot CDuceppe JSFazal GGoulet SGrand-Maître CGuse IHalmos TLavallée PLeach MMalenfant EO'Meara JPlante RPlouffe CPoirier MSoucy FYoakim CDéziel R Peptidomimetic inhibitors of the human cytomegalovirus protease. J Med Chem 40:4113-35 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pancreatic elastase
Name:Pancreatic elastase
Synonyms:Elastase 2A | Elastase-2 | Elastase-2A
Type:PROTEIN
Mol. Mass.:28705.23
Organism:Sus scrofa
Description:ChEMBL_156951
Residue:269
Sequence:
MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGG
TLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGN
DIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLV
VDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSS
LGCNYYHKPSVFTRVSNYIDWINSVIANN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061509
n/a
NameBDBM50061509
Synonyms:(S)-2-[(S)-2-(3,3-Dimethyl-butyrylamino)-3,3-dimethyl-butyrylamino]-N*4*,N*4*-dimethyl-N*1*-[1-methyl-2-(5-methyl-benzooxazol-2-yl)-2-oxo-ethyl]-succinamide | CHEMBL133854
TypeSmall organic molecule
Emp. Form.C29H43N5O6
Mol. Mass.557.6816
SMILESCC(NC(=O)[C@H](CC(=O)N(C)C)NC(=O)[C@@H](NC(=O)CC(C)(C)C)C(C)(C)C)C(=O)c1nc2cc(C)ccc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: