| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM26658 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_212193 (CHEMBL817756) |
|---|
| IC50 | 110800±n/a nM |
|---|
| Citation |  Checa, A; Ortiz, AR; de Pascual-Teresa, B; Gago, F Assessment of solvation effects on calculated binding affinity differences: trypsin inhibition by flavonoids as a model system for congeneric series. J Med Chem40:4136-45 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25790.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | P00760 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
|---|
| BDBM26658 |
|---|
| n/a |
|---|
| Name | BDBM26658 |
|---|
| Synonyms: | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-1-benzopyran-4-one | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxychromen-4-one | 2-[2,4-bis(oxidanyl)phenyl]-3,5,7-tris(oxidanyl)chromen-4-one | CHEMBL28626 | MLS000069618 | Morin (19) | Morin (5) | Morin (Mor) | SMR000058259 | cid_5281670 | morin |
|---|
| Type | Flavonoid |
|---|
| Emp. Form. | C15H10O7 |
|---|
| Mol. Mass. | 302.2357 |
|---|
| SMILES | Oc1ccc(c(O)c1)-c1oc2cc(O)cc(O)c2c(=O)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
