Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid receptor
LigandBDBM50061625
Substrate/Competitorn/a
Meas. Tech.ChEMBL_195492
Ki 30±n/a nM
Citation Umemiya HFukasawa HEbisawa MEyrolles LKawachi EEisenmann GGronemeyer HHashimoto YShudo KKagechika H Regulation of retinoidal actions by diazepinylbenzoic acids. Retinoid synergists which activate the RXR-RAR heterodimers. J Med Chem 40:4222-34 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid receptor
Name:Retinoic acid receptor RXR-alpha/Retinoic acid receptor beta
Synonyms:HBV-activated protein | Nuclear receptor subfamily 1 group B member 2 | RAR-beta | RAR-epsilon | Retinoic acid receptor beta
Type:PROTEIN
Mol. Mass.:50498.70
Organism:Homo sapiens (Human)
Description:ChEMBL_1458015
Residue:455
Sequence:
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK
IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061625
n/a
NameBDBM50061625
Synonyms:4-[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbamoyl]benzoic acid | Am 80 | CHEMBL25202 | Tamibarotene | retinobenzoic acid
TypeSmall organic molecule
Emp. Form.C22H25NO3
Mol. Mass.351.4388
SMILESCC1(C)CCC(C)(C)c2cc(NC(=O)c3ccc(cc3)C(O)=O)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: