Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM50061707
Substrate/Competitorn/a
Meas. Tech.ChEMBL_138289
IC50 99±n/a nM
Citation Bromidge SMBrown FCassidy FClark MSDabbs SHadley MSHawkins JLoudon JMNaylor CBOrlek BSRiley GJ Design of [R-(Z)]-(+)-alpha-(methoxyimino)-1-azabicyclo[2.2.2]octane-3-acetonitri le (SB 202026), a functionally selective azabicyclic muscarinic M1 agonist incorporating the N-methoxy imidoyl nitrile group as a novel ester bioisostere. J Med Chem 40:4265-80 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic acetylcholine receptor M1
Synonyms:CHRM1 | Cholinergic receptor, muscarinic 1 | Cholinergic, muscarinic M1
Type:Protein
Mol. Mass.:51442.54
Organism:Homo sapiens (Human)
Description:P11229
Residue:460
Sequence:
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061707
n/a
NameBDBM50061707
Synonyms:(1-Aza-bicyclo[3.2.1]oct-5-yl)-[(Z)-methoxyimino]-acetonitrile | CHEMBL135645
TypeSmall organic molecule
Emp. Form.C10H15N3O
Mol. Mass.193.2456
SMILESCO\N=C(/C#N)C12CCN(C1)CCC2
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: