Reaction Details |
| Report a problem with these data |
Target | Platelet-activating factor receptor |
---|
Ligand | BDBM50062118 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158347 (CHEMBL768491) |
---|
Ki | 0.910000±n/a nM |
---|
Citation | Curtin, ML; Davidsen, SK; Heyman, HR; Garland, RB; Sheppard, GS; Florjancic, AS; Xu, L; Carrera, GM; Steinman, DH; Trautmann, JA; Albert, DH; Magoc, TJ; Tapang, P; Rhein, DA; Conway, RG; Luo, G; Denissen, JF; Marsh, KC; Morgan, DW; Summers, JB Discovery and evaluation of a series of 3-acylindole imidazopyridine platelet-activating factor antagonists. J Med Chem41:74-95 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Platelet-activating factor receptor |
---|
Name: | Platelet-activating factor receptor |
Synonyms: | PAF-R | PTAFR | PTAFR_CAVPO | Platelet activating factor receptor | Platelet-activating factor receptor |
Type: | Protein |
Mol. Mass.: | 39005.63 |
Organism: | Cavia porcellus |
Description: | n/a |
Residue: | 342 |
Sequence: | MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
|
|
|
BDBM50062118 |
---|
n/a |
---|
Name | BDBM50062118 |
Synonyms: | 4-Ethyl-3-[4-(2-methyl-imidazo[4,5-c]pyridin-1-ylmethyl)-benzoyl]-indole-1-carboxylic acid dimethylamide | CHEMBL366553 |
Type | Small organic molecule |
Emp. Form. | C28H27N5O2 |
Mol. Mass. | 465.5463 |
SMILES | CCc1cccc2n(cc(C(=O)c3ccc(Cn4c(C)nc5cnccc45)cc3)c12)C(=O)N(C)C |
Structure |
|