| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Platelet activating factor receptor |
|---|
| Ligand | BDBM50062121 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158347 |
|---|
| Ki | 1.8±n/a nM |
|---|
| Citation |  Curtin ML; Davidsen SK; Heyman HR; Garland RB; Sheppard GS; Florjancic AS; Xu L; Carrera GM; Steinman DH; Trautmann JA; Albert DH; Magoc TJ; Tapang P; Rhein DA; Conway RG; Luo G; Denissen JF; Marsh KC; Morgan DW; Summers JB Discovery and evaluation of a series of 3-acylindole imidazopyridine platelet-activating factor antagonists. J Med Chem 41:74-95 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Platelet activating factor receptor |
|---|
| Name: | Platelet activating factor receptor |
|---|
| Synonyms: | PAF-R | Platelet-activating factor receptor |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 39005.63 |
|---|
| Organism: | Cavia porcellus |
|---|
| Description: | n/a |
|---|
| Residue: | 342 |
|---|
| Sequence: | MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
|
|
|
|---|
| BDBM50062121 |
|---|
| n/a |
|---|
| Name | BDBM50062121 |
|---|
| Synonyms: | 3-[4-(4-Chloro-2-methyl-imidazo[4,5-c]pyridin-1-ylmethyl)-benzoyl]-1-dimethylcarbamoyl-1H-indole-4-carboxylic acid methyl ester | CHEMBL354819 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H24ClN5O4 |
|---|
| Mol. Mass. | 529.974 |
|---|
| SMILES | COC(=O)c1cccc2n(cc(C(=O)c3ccc(Cn4c(C)nc5c(Cl)nccc45)cc3)c12)C(=O)N(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
