| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Platelet-activating factor receptor |
|---|
| Ligand | BDBM50062056 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158347 (CHEMBL768491) |
|---|
| Ki | 0.630000±n/a nM |
|---|
| Citation |  Curtin, ML; Davidsen, SK; Heyman, HR; Garland, RB; Sheppard, GS; Florjancic, AS; Xu, L; Carrera, GM; Steinman, DH; Trautmann, JA; Albert, DH; Magoc, TJ; Tapang, P; Rhein, DA; Conway, RG; Luo, G; Denissen, JF; Marsh, KC; Morgan, DW; Summers, JB Discovery and evaluation of a series of 3-acylindole imidazopyridine platelet-activating factor antagonists. J Med Chem41:74-95 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Platelet-activating factor receptor |
|---|
| Name: | Platelet-activating factor receptor |
|---|
| Synonyms: | PAF-R | PTAFR | PTAFR_CAVPO | Platelet activating factor receptor | Platelet-activating factor receptor |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 39005.63 |
|---|
| Organism: | Cavia porcellus |
|---|
| Description: | n/a |
|---|
| Residue: | 342 |
|---|
| Sequence: | MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
|
|
|
|---|
| BDBM50062056 |
|---|
| n/a |
|---|
| Name | BDBM50062056 |
|---|
| Synonyms: | 1-Dimethylcarbamoyl-3-{2-[4-(2-methyl-imidazo[4,5-c]pyridin-1-yl)-phenyl]-acetyl}-1H-indole-4-carboxylic acid methyl ester | CHEMBL172859 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H25N5O4 |
|---|
| Mol. Mass. | 495.5292 |
|---|
| SMILES | COC(=O)c1cccc2n(cc(C(=O)Cc3ccc(cc3)-n3c(C)nc4cnccc34)c12)C(=O)N(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
