Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetActivating transcription factor 1
LigandBDBM50062658
Substrate/Competitorn/a
Meas. Tech.ChEMBL_27877
IC50 150±n/a nM
Citation Sullivan RWBigam CGErdman PEPalanki MSAnderson DWGoldman MERansone LJSuto MJ 2-Chloro-4-(trifluoromethyl)pyrimidine-5-N-(3',5'- bis(trifluoromethyl)phenyl)-carboxamide: a potent inhibitor of NF-kappa B- and AP-1-mediated gene expression identified using solution-phase combinatorial chemistry. J Med Chem 41:413-9 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Activating transcription factor 1
Name:Activating transcription factor 1
Synonyms:Cyclic AMP-dependent transcription factor ATF-1 | Protein TREB36 | cAMP-dependent transcription factor ATF-1
Type:PROTEIN
Mol. Mass.:29236.24
Organism:Homo sapiens (Human)
Description:ChEMBL_27877
Residue:271
Sequence:
MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR
RPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQL
ASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQ
IRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKC
LENRVAVLENQNKTLIEELKTLKDLYSNKSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50062658
n/a
NameBDBM50062658
Synonyms:3-[(2-Chloro-4-trifluoromethyl-pyrimidine-5-carbonyl)-amino]-5-trifluoromethyl-benzoic acid ethyl ester | CHEMBL134490
TypeSmall organic molecule
Emp. Form.C16H10ClF6N3O3
Mol. Mass.441.712
SMILESCCOC(=O)c1cc(NC(=O)c2cnc(Cl)nc2C(F)(F)F)cc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: