Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNuclear factor NF-kappa-B (NF-kB)
LigandBDBM50062659
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143916
IC50 4000±n/a nM
Citation Sullivan RWBigam CGErdman PEPalanki MSAnderson DWGoldman MERansone LJSuto MJ 2-Chloro-4-(trifluoromethyl)pyrimidine-5-N-(3',5'- bis(trifluoromethyl)phenyl)-carboxamide: a potent inhibitor of NF-kappa B- and AP-1-mediated gene expression identified using solution-phase combinatorial chemistry. J Med Chem 41:413-9 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nuclear factor NF-kappa-B (NF-kB)
Name:Nuclear factor NF-kappa-B (NF-kB)
Synonyms:Nuclear factor NF-kappa-B complex | Nuclear factor NF-kappa-B p105 subunit
Type:Protein
Mol. Mass.:105329.57
Organism:Homo sapiens (Human)
Description:P19838
Residue:968
Sequence:
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50062659
n/a
NameBDBM50062659
Synonyms:2-Chloro-4-trifluoromethyl-pyrimidine-5-carboxylic acid (3-methyl-isoxazol-5-yl)-amide | CHEMBL335697
TypeSmall organic molecule
Emp. Form.C10H6ClF3N4O2
Mol. Mass.306.628
SMILESCc1cc(NC(=O)c2cnc(Cl)nc2C(F)(F)F)on1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: