| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50063807 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_200983 (CHEMBL801236) |
|---|
| Ki | 47±n/a nM |
|---|
| Citation |  Ucar, H; Van derpoorten, K; Cacciaguerra, S; Spampinato, S; Stables, JP; Depovere, P; Isa, M; Masereel, B; Delarge, J; Poupaert, JH Synthesis and anticonvulsant activity of 2(3H)-benzoxazolone and 2(3H)-benzothiazolone derivatives. J Med Chem41:1138-45 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50063807 |
|---|
| n/a |
|---|
| Name | BDBM50063807 |
|---|
| Synonyms: | 3-(2-Piperidin-1-yl-ethyl)-6-propionyl-3H-benzothiazol-2-one | CHEMBL14876 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H22N2O2S |
|---|
| Mol. Mass. | 318.434 |
|---|
| SMILES | CCC(=O)c1ccc2n(CCN3CCCCC3)c(=O)sc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
