Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 5
LigandBDBM50051567
Substrate/Competitorn/a
Meas. Tech.ChEMBL_200528
Ki 3700±n/a nM
Citation Hirschmann RHynes JCichy-Knight MAvan Rijn RDSprengeler PASpoors PGShakespeare WCPietranico-Cole SBarbosa JLiu JYao WRohrer SSmith AB Modulation of receptor and receptor subtype affinities using diastereomeric and enantiomeric monosaccharide scaffolds as a means to structural and biological diversity. A new route to ether synthesis. J Med Chem 41:1382-91 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 5
Name:Somatostatin receptor type 5
Synonyms:SOMATOSTATIN SST5 | SS-5-R | SS5-R | SS5R | Somatostatin receptor type 5 (SSTR5)
Type:Enzyme
Mol. Mass.:39218.02
Organism:Homo sapiens (Human)
Description:P35346
Residue:364
Sequence:
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG
VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV
QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR
RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ
TSKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50051567
n/a
NameBDBM50051567
Synonyms:5-{(2R,3R,4S,5R,6R)-3,4,5-Tris-benzyloxy-6-[2-(1H-indol-3-yl)-ethoxy]-tetrahydro-pyran-2-ylmethoxy}-pentylamine | 5-{3,4,5-Tris-benzyloxy-6-[2-(1H-indol-3-yl)-ethoxy]-tetrahydro-pyran-2-ylmethoxy}-pentylamine | CHEMBL282618
TypeSmall organic molecule
Emp. Form.C42H50N2O6
Mol. Mass.678.8562
SMILESNCCCCCOC[C@H]1O[C@@H](OCCc2c[nH]c3ccccc23)[C@H](OCc2ccccc2)[C@@H](OCc2ccccc2)[C@@H]1OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: