Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50064171
Substrate/Competitorn/a
Meas. Tech.ChEMBL_200978
Ki 0.62±n/a nM
Citation Quaglia WGiannella MPiergentili APigini MBrasili LDi Toro RRossetti LSpampinato SMelchiorre C 1'-Benzyl-3,4-dihydrospiro[2H-1- benzothiopyran-2,4'-piperidine] (spipethiane), a potent and highly selective sigma1 ligand. J Med Chem 41:1557-60 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064171
n/a
NameBDBM50064171
Synonyms:1'-benzylspiro[3,4-dihydro-2H-chromene-2,4'-(hexahydropyridine)] | 1'-benzylspiro[chroman-2,4'-piperidine] | CHEMBL38634
TypeSmall organic molecule
Emp. Form.C20H23NO
Mol. Mass.293.4027
SMILESC(N1CCC2(CC1)CCc1ccccc1O2)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: