| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50064171 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_200978 (CHEMBL802065) |
|---|
| Ki | 0.62±n/a nM |
|---|
| Citation |  Quaglia, W; Giannella, M; Piergentili, A; Pigini, M; Brasili, L; Di Toro, R; Rossetti, L; Spampinato, S; Melchiorre, C 1'-Benzyl-3,4-dihydrospiro[2H-1- benzothiopyran-2,4'-piperidine] (spipethiane), a potent and highly selective sigma1 ligand. J Med Chem41:1557-60 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50064171 |
|---|
| n/a |
|---|
| Name | BDBM50064171 |
|---|
| Synonyms: | 1'-benzylspiro[3,4-dihydro-2H-chromene-2,4'-(hexahydropyridine)] | 1'-benzylspiro[chroman-2,4'-piperidine] | CHEMBL38634 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23NO |
|---|
| Mol. Mass. | 293.4027 |
|---|
| SMILES | C(N1CCC2(CC1)CCc1ccccc1O2)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
